PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G23250.1
Common NameATMYB15, ATY19, MYB15
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 285aa    MW: 32041.7 Da    PI: 4.9936
Description myb domain protein 15
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G23250.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++lv  +  +G  +W++ ++  g+ R++k+c++rw +yl
      AT3G23250.1 14 RGPWTPEEDQILVSFILNHGHSNWRALPKQAGLLRCGKSCRLRWMNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding51.71.9e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ ++ +++ lG++ W++Ia++++ gRt++++k+ w+++l
      AT3G23250.1  67 RGNFTKEEEDAIISLHQILGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.547961IPR017930Myb domain
SuperFamilySSF466895.5E-3010108IPR009057Homeodomain-like
SMARTSM007171.8E-121363IPR001005SANT/Myb domain
PfamPF002494.4E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-241568IPR009057Homeodomain-like
CDDcd001671.31E-91661No hitNo description
PROSITE profilePS5129425.06462116IPR017930Myb domain
SMARTSM007177.3E-1566114IPR001005SANT/Myb domain
PfamPF002496.7E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2669116IPR009057Homeodomain-like
CDDcd001676.93E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0030154Biological Processcell differentiation
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009031anatomysepal
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MGRAPCCEKM GLKRGPWTPE EDQILVSFIL NHGHSNWRAL PKQAGLLRCG KSCRLRWMNY  60
LKPDIKRGNF TKEEEDAIIS LHQILGNRWS AIAAKLPGRT DNEIKNVWHT HLKKRLEDYQ  120
PAKPKTSNKK KGTKPKSESV ITSSNSTRSE SELADSSNPS GESLFSTSPS TSEVSSMTLI  180
SHDGYSNEIN MDNKPGDIST IDQECVSFET FGADIDESFW KETLYSQDEH NYVSNDLEVA  240
GLVEIQQEFQ NLGSANNEMI FDSEMDFWFD VLARTGGEQD LLAGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27121175109B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.53480.0leaf| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible257919_at0.0
Expression AtlasAT3G23250-
AtGenExpressAT3G23250-
ATTED-IIAT3G23250-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Function -- GeneRIF ? help Back to Top
  1. myb15 mutant plants show increased tolerance to freezing stress whereas its overexpression reduces freezing tolerance
    [PMID: 17015446]
  2. transgenic expression of MYB15, encoding a R2R3 MYB transcription factor in Arabidopsis thaliana, conferred hypersensitivity to exogenous abscisic acid (ABA) and improved tolerance to drought and salt stresses
    [PMID: 19161942]
  3. Data show that constitutive expression of aminocyclopropane-1-carboxylate oxidase gene, TaACO1 in Arabidopsis increased AtMYB15 expression.
    [PMID: 25048023]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G23250.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT3G26744 (R)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT4G25470(R), AT4G25480(R), AT4G25490(R)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDauxin, ethylene, jasmonic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G26744
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G23250
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1766170.0AK176617.1 Arabidopsis thaliana mRNA for putative myb-related transcription factor, complete cds, clone: RAFL25-14-I20.
GenBankAK1766930.0AK176693.1 Arabidopsis thaliana mRNA for putative myb-related transcription factor, complete cds, clone: RAFL25-23-N24.
GenBankAY5502960.0AY550296.1 Arabidopsis thaliana MYB transcription factor (At3g23250) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_188966.10.0myb domain protein 15
TrEMBLQ9LTC40.0Q9LTC4_ARATH; At3g23250
STRINGAT3G23250.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Boisson B,Giglione C,Meinnel T
    Unexpected protein families including cell defense components feature in the N-myristoylome of a higher eukaryote.
    J. Biol. Chem., 2003. 278(44): p. 43418-29
    [PMID:12912986]
  4. Guan Y,Nothnagel EA
    Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures.
    Plant Physiol., 2004. 135(3): p. 1346-66
    [PMID:15235117]
  5. Miao Y,Laun T,Zimmermann P,Zentgraf U
    Targets of the WRKY53 transcription factor and its role during leaf senescence in Arabidopsis.
    Plant Mol. Biol., 2004. 55(6): p. 853-67
    [PMID:15604721]
  6. Suzuki N, et al.
    Enhanced tolerance to environmental stress in transgenic plants expressing the transcriptional coactivator multiprotein bridging factor 1c.
    Plant Physiol., 2005. 139(3): p. 1313-22
    [PMID:16244138]
  7. Taki N, et al.
    12-oxo-phytodienoic acid triggers expression of a distinct set of genes and plays a role in wound-induced gene expression in Arabidopsis.
    Plant Physiol., 2005. 139(3): p. 1268-83
    [PMID:16258017]
  8. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  9. Thilmony R,Underwood W,He SY
    Genome-wide transcriptional analysis of the Arabidopsis thaliana interaction with the plant pathogen Pseudomonas syringae pv. tomato DC3000 and the human pathogen Escherichia coli O157:H7.
    Plant J., 2006. 46(1): p. 34-53
    [PMID:16553894]
  10. Rigola D,Fiers M,Vurro E,Aarts MG
    The heavy metal hyperaccumulator Thlaspi caerulescens expresses many species-specific genes, as identified by comparative expressed sequence tag analysis.
    New Phytol., 2006. 170(4): p. 753-65
    [PMID:16684236]
  11. Zheng W, et al.
    Bestatin, an inhibitor of aminopeptidases, provides a chemical genetics approach to dissect jasmonate signaling in Arabidopsis.
    Plant Physiol., 2006. 141(4): p. 1400-13
    [PMID:16798948]
  12. Agarwal M, et al.
    A R2R3 type MYB transcription factor is involved in the cold regulation of CBF genes and in acquired freezing tolerance.
    J. Biol. Chem., 2006. 281(49): p. 37636-45
    [PMID:17015446]
  13. Jiang Y,Deyholos MK
    Comprehensive transcriptional profiling of NaCl-stressed Arabidopsis roots reveals novel classes of responsive genes.
    BMC Plant Biol., 2006. 6: p. 25
    [PMID:17038189]
  14. Miura K, et al.
    SIZ1-mediated sumoylation of ICE1 controls CBF3/DREB1A expression and freezing tolerance in Arabidopsis.
    Plant Cell, 2007. 19(4): p. 1403-14
    [PMID:17416732]
  15. Gonzalez D,Bowen AJ,Carroll TS,Conlan RS
    The transcription corepressor LEUNIG interacts with the histone deacetylase HDA19 and mediator components MED14 (SWP) and CDK8 (HEN3) to repress transcription.
    Mol. Cell. Biol., 2007. 27(15): p. 5306-15
    [PMID:17526732]
  16. Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
    Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor.
    Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11
    [PMID:17722694]
  17. Ehlting J, et al.
    Comparative transcriptome analysis of Arabidopsis thaliana infested by diamond back moth (Plutella xylostella) larvae reveals signatures of stress response, secondary metabolism, and signalling.
    BMC Genomics, 2008. 9: p. 154
    [PMID:18400103]
  18. Ding Z, et al.
    Transgenic expression of MYB15 confers enhanced sensitivity to abscisic acid and improved drought tolerance in Arabidopsis thaliana.
    J Genet Genomics, 2009. 36(1): p. 17-29
    [PMID:19161942]
  19. Lippold F, et al.
    AtMyb41 regulates transcriptional and metabolic responses to osmotic stress in Arabidopsis.
    Plant Physiol., 2009. 149(4): p. 1761-72
    [PMID:19211694]
  20. Eckardt NA
    CAMTA proteins: a direct link between calcium signals and cold acclimation?
    Plant Cell, 2009. 21(3): p. 697
    [PMID:19270185]
  21. Doherty CJ,Van Buskirk HA,Myers SJ,Thomashow MF
    Roles for Arabidopsis CAMTA transcription factors in cold-regulated gene expression and freezing tolerance.
    Plant Cell, 2009. 21(3): p. 972-84
    [PMID:19270186]
  22. Miura K,Hasegawa PM
    Regulation of cold signaling by sumoylation of ICE1.
    Plant Signal Behav, 2008. 3(1): p. 52-3
    [PMID:19704769]
  23. Chen CC,Liang CS,Kao AL,Yang CC
    HHP1, a novel signalling component in the cross-talk between the cold and osmotic signalling pathways in Arabidopsis.
    J. Exp. Bot., 2010. 61(12): p. 3305-20
    [PMID:20566565]
  24. Li C, et al.
    TaCHP: a wheat zinc finger protein gene down-regulated by abscisic acid and salinity stress plays a positive role in stress tolerance.
    Plant Physiol., 2010. 154(1): p. 211-21
    [PMID:20639406]
  25. Liu R, et al.
    Thirty-seven transcription factor genes differentially respond to a harpin protein and affect resistance to the green peach aphid in Arabidopsis.
    J. Biosci., 2010. 35(3): p. 435-50
    [PMID:20826953]
  26. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  27. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  28. H
    The R2R3-MYB transcription factors MYB14 and MYB15 regulate stilbene biosynthesis in Vitis vinifera.
    Plant Cell, 2013. 25(10): p. 4135-49
    [PMID:24151295]
  29. Chen D, et al.
    A wheat aminocyclopropane-1-carboxylate oxidase gene, TaACO1, negatively regulates salinity stress in Arabidopsis thaliana.
    Plant Cell Rep., 2014. 33(11): p. 1815-27
    [PMID:25048023]
  30. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  31. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]